missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APLF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | APLF |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18675795
|
Novus Biologicals
NBP2-38212-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18197378
|
Novus Biologicals
NBP2-38212 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
APLF Polyclonal specifically detects APLF in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| APLF | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8IW19 | |
| 200558 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| APFL, aprataxin- and PNK-like factor, aprataxin and PNK-like factor, aprataxin and PNKP like factor, Apurinic-apyrimidinic endonuclease APLF, C2orf13FLJ16593, chromosome 2 open reading frame 13, EC 4.2.99.18, MGC47799, PALF, PNK and APTX-like FHA domain-containing protein, PNK and APTX-like FHA protein, Xip1, XRCC1-interacting protein 1 | |
| APLF | |
| IgG | |
| Affinity Purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts