missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOBEC1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92341-0.02ml
This item is not returnable.
View return policy
Description
APOBEC1 Polyclonal antibody specifically detects APOBEC1 in Mouse samples. It is validated for Western Blot
Specifications
| APOBEC1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| APOBEC-1, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1, Apolipoprotein B mRNA-editing enzyme 1, BEDPC->U-editing enzyme APOBEC-1, CDAR1, EC 3.5.4, EC 3.5.4.-, HEPRapolipoprotein B mRNA editing enzyme complex-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP_001291495). MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSM | |
| 0.02 mL | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 339 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction