missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOBEC3D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49168
This item is not returnable.
View return policy
Description
APOBEC3D Polyclonal antibody specifically detects APOBEC3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| APOBEC3D | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| APOBEC3DE, APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative), apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene, ARP6, DNA dC->dU-editing enzyme APOBEC-3D, EC 3.5.4, EC 3.5.4.-, probable DNA dC->dU-editing enzyme APOBEC-3D | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VFRGPVLPKRQSNHRQEVYFRFENHAEMCF | |
| 0.1 mL | |
| Cell Biology | |
| 140564 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction