missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Aquaporin 1/AQP1 Polyclonal specifically detects Aquaporin 1/AQP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Classification | Polyclonal |
| Gene Symbols | AQP1 |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Purification Method | Affinity Purified |
| Quantity | 0.1 mL |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?