missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Aquaporin 1/AQP1 Antibody, Novus Biologicals™

Aquaporin 1/AQP1 Antibody, Novus Biologicals™

Product Code. 18700944 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18700944 0.1 mL 0.1mL
18410161 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18700944 Supplier Novus Biologicals Supplier No. NBP184488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Aquaporin 1/AQP1 Polyclonal specifically detects Aquaporin 1/AQP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Classification Polyclonal
Gene Symbols AQP1
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Purification Method Affinity Purified
Quantity 0.1 mL
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.