missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-9 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 209.00 - € 474.00
Specifications
| Antigen | Aquaporin-9 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18690172
|
Novus Biologicals
NBP2-92558-0.02ml |
0.02 mL |
€ 209.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18613052
|
Novus Biologicals
NBP2-92558-0.1ml |
0.1 mL |
€ 474.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aquaporin-9 Polyclonal antibody specifically detects Aquaporin-9 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Aquaporin-9 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 366 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| AQP-9, Aquaglyceroporin-9, aquaporin 9, aquaporin-9, HsT17287, Small solute channel 1, SSC1aquaglyceroporin-9 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human Aquaporin-9 (NP_066190.2). SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title