missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL17A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-59794
This item is not returnable.
View return policy
Description
ARL17A Polyclonal specifically detects ARL17A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ARL17A | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ADP Ribosylation Factor Like GTPase 17A, ADP-Ribosylation Factor 1 Pseudogene 2, ADP-Ribosylation Factor 7, ADP-Ribosylation Factor 7 Variant, ADP-Ribosylation Factor Like GTPase 17A ADP-Ribosylation Factor-Like 17 Pseudogene 1, ADP-Ribosylation Factor-Like 17-Like, ADP-ribosylation factor-like protein 17, ARF1P2, ARL17A ARL17B, ARL17P1 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 51326 | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ARL17A | |
| This antibody was developed against a recombinant protein corresponding to the amino acid sequence:IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only (RUO)
Spot an opportunity for improvement?Share a Content Correction