missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL2BP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | ARL2BP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARL2BP Polyclonal specifically detects ARL2BP in Mouse samples. It is validated for Western Blot.Specifications
| ARL2BP | |
| Polyclonal | |
| Rabbit | |
| Q9D385 | |
| 23568 | |
| Synthetic peptide corresponding to mouse Arl2bp - C-terminal region (NP_077231). Peptide Sequence: LQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVT | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ADP-ribosylation factor-like 2 binding protein, ADP-ribosylation factor-like protein 2-binding protein, ARF-like 2-binding protein, BART1binder of Arl Two, BARTArf-like 2 binding protein BART1, Binder of ARF2 protein 1, binder of Arl2 | |
| ARL2BP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title