missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | ARL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARL3 Polyclonal specifically detects ARL3 in Human samples. It is validated for Western Blot.Specifications
| ARL3 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| 403 | |
| Synthetic peptides corresponding to ARL3 (ADP-ribosylation factor-like 3) The peptide sequence was selected from the N terminal of ARL3. Peptide sequence QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ADP-ribosylation factor-like 3, ARFL3ADP-ribosylation factor-like protein 3, ARF-like 3 | |
| ARL3 | |
| IgG | |
| 20 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title