missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL6IP4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 209.00 - € 463.00
Specifications
| Antigen | ARL6IP4 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:2000, ELISA |
| Applications | Western Blot, ELISA |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693882
|
Novus Biologicals
NBP2-92711-0.02ml |
0.02 mL |
€ 209.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18680552
|
Novus Biologicals
NBP2-92711-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ARL6IP4 Polyclonal antibody specifically detects ARL6IP4 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISASpecifications
| ARL6IP4 | |
| Western Blot, ELISA | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 51329 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ADP-ribosylation-like factor 6 interacting protein 4, Aip-4, ARL-6-interacting protein 4, HSP-975, HSVI binding protein, HSVI-binding protein, MGC814, SFRS20, splicing factor, arginine/serine-rich 20, splicing regulator SRrp38, SR-15, SR-25ADP-ribosylation factor-like protein 6-interacting protein 4, SRp25 nuclear protein, SRp25aip-4, SRrp37 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3). SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title