missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL8A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14315-25ul
This item is not returnable.
View return policy
Description
ARL8A Polyclonal antibody specifically detects ARL8A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ARL8A | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| ADP-ribosylation factor-like 10B, ADP-ribosylation factor-like 8A, ADP-ribosylation factor-like protein 10B, ADP-ribosylation factor-like protein 8A, ARL10B, FLJ45195, GIE2, Novel small G protein indispensable for equal chromosome segregation 2, small G protein indispensable for equal chromosome segregation 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRK | |
| 25 μL | |
| Signal Transduction | |
| 127829 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction