missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL8B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92570-0.1ml
This item is not returnable.
View return policy
Description
ARL8B Polyclonal antibody specifically detects ARL8B in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| ARL8B | |
| Polyclonal | |
| Western Blot 1:500-1:3000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| ADP-ribosylation factor-like 10C, ADP-ribosylation factor-like 8B, ADP-ribosylation factor-like protein 10C, ADP-ribosylation factor-like protein 8B, ARL10C, FLJ10702, Gie1, Novel small G protein indispensable for equal chromosome segregation 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 127-186 of human ARL8B (NP_060654.1). VLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS | |
| 0.1 mL | |
| Signal Transduction | |
| 55207 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction