missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARMER Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | ARMER |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18479851
|
Novus Biologicals
NBP1-91681-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18735883
|
Novus Biologicals
NBP1-91681 |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
ARMER Polyclonal specifically detects ARMER in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ARMER | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q15041 | |
| 23204 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADP-ribosylation factor-like 6 interacting protein, ADP-ribosylation factor-like 6 interacting protein 1, Aip-1, AIP1, apoptotic regulator in the membrane of the endoplasmic reticulum, ARL-6-interacting protein 1, ARL6IPaip-1, ARMER, KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1 | |
| ARL6IP1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title