missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody, Novus Biologicals™

ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody, Novus Biologicals™

Product Code. 18600458 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18600458 0.1 mL 0.1mL
18663019 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18600458 Supplier Novus Biologicals Supplier No. NBP249326

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Descrizione

Rabbit Polyclonal Antibody

ASAH2/N-acylsphingosine Amidohydrolase-2 Polyclonal antibody specifically detects ASAH2/N-acylsphingosine Amidohydrolase-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifica

Antigen ASAH2/N-acylsphingosine Amidohydrolase-2
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias ASAH2 N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2, BCDase, HNAC1, LCDase, NCDase, N-CDase
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 56624
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.