missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASCC2 Antibody (3B2), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00084164-M07
This item is not returnable.
View return policy
Description
ASCC2 Monoclonal antibody specifically detects ASCC2 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| ASCC2 | |
| Monoclonal | |
| Unconjugated | |
| NP_115580 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 84164 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 3B2 | |
| In 1x PBS, pH 7.4 | |
| activating signal cointegrator 1 complex subunit 2, ASC 1 complex subunit P100, ASC-1 complex subunit p100, ASC1p100, DKFZp586O0223, FLJ21588, Trip4 complex subunit p100 | |
| ASCC2 (NP_115580, 672 a.a. ∽ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction