missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASCIZ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | ASCIZ |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18696695
|
Novus Biologicals
NBP2-39079-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18112059
|
Novus Biologicals
NBP2-39079 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ASCIZ Polyclonal specifically detects ASCIZ in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ASCIZ | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ASCIZ, ATM INteracting protein, ATM interactor, ATM/ATR-substrate CHK2-interacting zinc finger protein, ATM/ATR-Substrate Chk2-Interacting Zn++-finger protein, DKFZp779K1455, FLJ50270, FLJ61620, FLJ76795, KIAA0431, zinc finger protein 822, ZNF822 | |
| ATMIN | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O43313 | |
| 23300 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TFRCTCGCPYASRTALQSHIYRTGHEIPAEHRDPPSKKRKMENCAQNQKLSNKTIESLNNQPIPRPDTQELEASEIKLEPSFEDSCGSNTD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title