missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASCL4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92741-0.02ml
This item is not returnable.
View return policy
Description
ASCL4 Polyclonal antibody specifically detects ASCL4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ASCL4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin | |
| achaete-scute complex homolog 4 (Drosophila), bHLHa44, class A basic helix-loop-helix protein 44, class II bHLH protein ASCL4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3). METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 121549 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction