missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18235434

R&D Systems™ Asparagine synthetase Recombinant Protein Antigen

Código de producto. 18235434 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Quantity:
100 μL
Tamaño de la unidad:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity Tamaño de la unidad
18235434 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18235434 Proveedor R&D Systems™ N.º de proveedor NBP256407PEP
 Restricted Item
Estimated Shipment: 15-01-2027
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Asparagine synthetase. Source: E.coli Amino Acid Sequence: MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ The Asparagine synthetase Recombinant Protein Antigen is derived from E. coli. The Asparagine synthetase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 440
Product Line Novus
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name Asparagine synthetase Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias asparagine synthetase, asparagine synthetase (glutamine-hydrolyzing), asparagine synthetase [glutamine-hydrolyzing], Cell cycle control protein TS11, EC 6.3.5.4, Glutamine-dependent asparagine synthetase, TS11, TS11 cell cycle control protein
Gene Symbol ASNS
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50646. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mostrar más Mostrar menos

For Research Use Only.

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.