missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Ataxin 1 Monoclonal Antibody (N76/8), FITC
GREENER_CHOICE

Mouse Monoclonal Antibody

Brand:  Invitrogen™ MA545663

Product Code. 17878292

  • € 467.00 / 100µg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Description

Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). 1 μg/mL of MA5-45663 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody. Detects approximately 85kDa. This antibody was formerly sold as clone S76-8.

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the 'pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Ataxin 1
Monoclonal
1 mg/mL
PBS, 9.09mM sodium bicarbonate with 640.91mM DMSO, 136.36mM ethanolamine and no preservative; pH 7.4
P54253, P54254, Q63540
ATXN1
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1.
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG2b
Immunohistochemistry, Immunoprecipitation, Western Blot, Immunocytochemistry
N76/8
FITC
ATXN1
2900016G23Rik; alternative ataxin1; ataxin 1; Ataxin1; ataxin-1; Atx1; Atx-1; Atx-1-PB; Atxn1; C85907; CG4547; CG4547-PB; D6S504E; dAtx-1; Dmel\CG4547; Dmel_CG4547; ENSMUSG00000074917; Gm10786; OTTHUMP00000016065; SCA1; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
Mouse
Protein G
RUO
20238, 25049, 6310
4°C, store in dark
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.