missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1G3 Antibody (3A5), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00127124-M13
This item is not returnable.
View return policy
Description
ATP6V1G3 Monoclonal antibody specifically detects ATP6V1G3 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| ATP6V1G3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3, H+ transporting, lysosomal (vacuolar proton pump) subunit G3, MGC119810, MGC119813, vacuolar ATP synthase subunit G 3, vacuolar proton pump G subunit 3, Vacuolar proton pump subunit G 3, vacuolar proton pump, subunit G3, V-ATPase 13 kDa subunit 3, V-ATPase G subunit 3, V-ATPase G3 subunit, V-ATPase subunit G 3, V-type proton ATPase subunit G 3 | |
| ATP6V1G3 (NP_573569, 38 a.a. ∽ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN | |
| 0.1 mg | |
| Cancer, Endocrinology, Signal Transduction | |
| 127124 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 3A5 | |
| Western Blot 1:500, ELISA, Sandwich ELISA | |
| NP_573569 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction