missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1H Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 292.00 - € 572.00
Specifications
| Antigen | ATP6V1H |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18489201
|
Novus Biologicals
NBP1-85668-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18268916
|
Novus Biologicals
NBP1-85668 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ATP6V1H Polyclonal specifically detects ATP6V1H in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ATP6V1H | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51606 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H, ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H, CGI-11, MSTP042, NBP1, Nef-binding protein 1, Protein VMA13 homolog, SFD, SFDalpha, SFDbeta, vacuolar ATP synthase subunit H, vacuolar ATPase subunit H, vacuolar proton pump H subunit, Vacuolar proton pump subunit H, Vacuolar proton pump subunit SFD, V-ATPase 50/57 kDa subunits, V-ATPase H subunit, V-ATPase subunit H, VMA13, V-type proton ATPase subunit H | |
| ATP6V1H | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title