missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Atrial Natriuretic Peptide/ANP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Especificaciones
| Antigen | Atrial Natriuretic Peptide/ANP |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
30228499
|
Novus Biologicals
NBP3-35467-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227840
|
Novus Biologicals
NBP3-35467-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
Atrial Natriuretic Peptide/ANP Polyclonal antibody specifically detects Atrial Natriuretic Peptide/ANP in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Especificaciones
| Atrial Natriuretic Peptide/ANP | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| ANF, ANPatriopeptin, ATFB6, atrial natriuretic factor, Atrial natriuretic peptide, CDD-ANF, natriuretic peptide A, natriuretic peptide precursor A, PNDcardionatrin, prepronatriodilatin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).,, Sequence:, LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 4878 | |
| IgG | |
| Affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto