missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B3GNT8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33400
This item is not returnable.
View return policy
Description
B3GNT8 Polyclonal specifically detects B3GNT8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| B3GNT8 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q7Z7M8 | |
| B3GNT8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TPANPEPTLPANLSTRLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLP | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| B3GALT7, Beta Galactosyltransferase BGALT15, beta-1,3-Gn-T8, beta-1,3-N-acetylglucosaminyltransferase 8, Beta1,3-N-Acetylglucosaminyltransferase 8, beta3Gn-T8, BGALT15, BGnT-8, EC 2.4.1.-, UDP-Gal:BetaGal Beta 1,3-Galactosyltransferase Polypeptide 7, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 374907 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto