missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | BAAT |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18482991
|
Novus Biologicals
NBP2-14344-25ul |
25ul |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18198131
|
Novus Biologicals
NBP2-14344 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BAAT Polyclonal specifically detects BAAT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| BAAT | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 570 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| BACAT, BATbile acid-CoA:amino acid N-acyltransferase, bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase), bile acid Coenzyme A: amino acid N-acyltransferase (glycineN-choloyltransferase), EC 2.3.1.65, EC 3.1.2.2, FLJ20300, Glycine N-choloyltransferase, Long-chain fatty-acyl-CoA hydrolase, MGC104432 | |
| BAAT | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title