missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAFF/BLyS/TNFSF13B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 401.00 - € 600.00
Specifications
| Antigen | BAFF/BLyS/TNFSF13B |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18699144
|
Novus Biologicals
NBP3-21252-100ul |
100 μg |
€ 600.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661984
|
Novus Biologicals
NBP3-21252-25ul |
25 μg |
€ 401.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BAFF/BLyS/TNFSF13B Polyclonal antibody specifically detects BAFF/BLyS/TNFSF13B in Human samples. It is validated for ImmunofluorescenceSpecifications
| BAFF/BLyS/TNFSF13B | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology | |
| PBS, pH 7.2, 40% glycerol | |
| 10673 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title