missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAGE2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05566-100ul
This item is not returnable.
View return policy
Description
BAGE2 Polyclonal antibody specifically detects BAGE2 in Human samples. It is validated for Western Blot
Specifications
| BAGE2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| B melanoma antigen 2, B melanoma antigen family, member 2, cancer/testis antigen family 2, member 2, CT2.2Cancer/testis antigen 2.2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 18-109 of human BAGE2 (NP_872288.2). RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS | |
| 100 μg | |
| Cell Biology | |
| 85319 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction