missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAIAP2L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 572.00
Specifications
| Antigen | BAIAP2L1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18413021
|
Novus Biologicals
NBP1-89537-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18240886
|
Novus Biologicals
NBP1-89537 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BAIAP2L1 Polyclonal specifically detects BAIAP2L1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| BAIAP2L1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55971 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| BAI1-associated protein 2-like 1, BAI1-associated protein 2-like protein 1, brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1, FLJ42275, IRTKSInsulin receptor tyrosine kinase substrate | |
| BAIAP2L1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human BIAP2L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title