missing translation for 'onlineSavingsMsg'
Learn More

Bcl-6 Antibody, Novus Biologicals™

Product Code. p-200084544 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18654650 25 μL 25µL
18208019 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18654650 Supplier Novus Biologicals Supplier No. NBP27654125ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Bcl-6 Polyclonal specifically detects Bcl-6 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Bcl-6
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias B-cell CLL/lymphoma 6, B-cell lymphoma 6 protein transcript, BCL-5, BCL5B-cell lymphoma 5 protein, BCL-6, BCL6A, cys-his2 zinc finger transcription factor, LAZ3ZBTB27B-cell lymphoma 6 protein, lymphoma-associated zinc finger gene on chromosome 3, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51ZNF51, zinc finger transcription factor BCL6S
Gene Symbols BCL6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 604.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.