missing translation for 'onlineSavingsMsg'
Learn More

BDH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-55042

Se fler versioner av denna produkt

Produktkod. 18256352

€ 624.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

BDH1 Polyclonal specifically detects BDH1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifikationer

Antigen	BDH1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias	(R)-3-hydroxybutyrate dehydrogenase, 3-hydroxybutyrate dehydrogenase, 3-hydroxybutyrate dehydrogenase, type 1, EC 1.1.1, MGC2723, MGC4347, MGC9788, mitochondrial, mitochondrial), short chain dehydrogenase/reductase family 9C, member 1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	BDH1
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK
Quantity	100 μL
Research Discipline	metabolism
Gene ID (Entrez)	622
Target Species	Human
Isotype	IgG

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

BDH1 Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer