missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BEN Domain Containing 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-31576-25ul
This item is not returnable.
View return policy
Description
BEN Domain Containing 5 Polyclonal specifically detects BEN Domain Containing 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| BEN Domain Containing 5 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q7L4P6 | |
| BEND5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSG | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BEN domain containing 5, BEN Domain-Containing Protein 5, BEND5, C1orf165, chromosome 1 open reading frame 165, FLJ11588 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79656 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu