missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Bestrophin 1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 470.00
Specifications
| Antigen | Bestrophin 1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18696951
|
Novus Biologicals
NBP2-92985-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603861
|
Novus Biologicals
NBP2-92985-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Bestrophin 1 Polyclonal antibody specifically detects Bestrophin 1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Bestrophin 1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Sensory Systems, Vision | |
| PBS with 50% glycerol, pH7.3. | |
| 7439 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ARB, BEST, Best disease, bestrophin 1, bestrophin-1, BMD, TU15B, vitelliform macular dystrophy 2, Vitelliform macular dystrophy protein 2, VMD2RP50 | |
| A synthetic peptide corresponding to a sequence within amino acids 171-270 of human Bestrophin 1 (NP_004174.1). LEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title