missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BET1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 209.00 - € 487.00
Specifications
| Antigen | BET1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18607582
|
Novus Biologicals
NBP2-92710-0.02ml |
0.02 mL |
€ 209.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18654132
|
Novus Biologicals
NBP2-92710-0.1ml |
0.1 mL |
€ 487.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BET1 Polyclonal antibody specifically detects BET1 in Human samples. It is validated for Western BlotSpecifications
| BET1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 10282 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Bet1 (S. cerevisiae) homolog, BET1 homolog, BET1 homolog (S. cerevisiae), Bet1p homolog, blocked early in transport 1 homolog (S. cerevisiae), DKFZp781C0425, Golgi vesicular membrane trafficking protein p18, Golgi vesicular membrane-trafficking protein p18, HBET1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human BET1 (NP_005859.1). MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title