missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta Adducin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33974-25ul
This item is not returnable.
View return policy
Description
beta Adducin Polyclonal specifically detects beta Adducin in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| beta Adducin | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P35612 | |
| ADD2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHF | |
| 25 μL | |
| Stem Cell Markers | |
| 119 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADDBErythrocyte adducin subunit beta, adducin 2 (beta), beta adducin, beta-adducin | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur