missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BMAL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 559.00
Specifications
| Antigen | BMAL1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18227124
|
Novus Biologicals
NBP2-56754 |
100 μL |
€ 559.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18654297
|
Novus Biologicals
NBP2-56754-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BMAL1 Polyclonal specifically detects BMAL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| BMAL1 | |
| Polyclonal | |
| Rabbit | |
| Cholesterol Metabolism, Chromatin Research, Circadian Rhythm, Hypoxia, Lipid and Metabolism, Neuroscience, Transcription Factors and Regulators, Vision | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 406 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| aryl hydrocarbon receptor nuclear translocator-like, aryl hydrocarbon receptor nuclear translocator-like protein 1, basic-helix-loop-helix-PAS orphan MOP3, BHLHE5, bHLHe5brain and muscle, bHLH-PAS protein JAP3, BMAL1TIC, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, member of PAS superfamily 3, MOP3BMAL1c, PAS domain-containing protein 3, PASD3MGC47515 | |
| ARNTL | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title