missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Brg1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 237.00 - € 471.00
Specifications
| Antigen | Brg1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:20 - 1:50, Knockout Validated |
| Applications | Western Blot, Immunofluorescence, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18617490
|
Novus Biologicals
NBP2-92957-0.02ml |
0.02 mL |
€ 237.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18642741
|
Novus Biologicals
NBP2-92957-0.1ml |
0.1 mL |
€ 471.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Brg1 Polyclonal antibody specifically detects Brg1 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Gene Knock-OutSpecifications
| Brg1 | |
| Western Blot, Immunofluorescence, Gene Knock-Out | |
| Unconjugated | |
| Rabbit | |
| Cancer, Chromatin Modifiers, Neuroscience, Stem Cells | |
| PBS with 50% glycerol, pH7.3. | |
| 6597 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:20 - 1:50, Knockout Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ATP-dependent helicase SMARCA4, BAF190, BAF190A, brahma protein-like 1, BRG1-associated factor 190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 4, BRM/SWI2-related gene 1, EC 3.6.1, EC 3.6.4.-, FLJ39786, global transcription activator homologous sequence, homeotic gene regulator, hSNF2b, Mitotic growth and transcription activator, nuclear protein GRB1, Protein brahma homolog 1, Protein BRG-1, RTPS2, SNF2, SNF2B, SNF2-BETA, SNF2L4, SNF2LB, SNF2-like 4, subfamily a, member 4, sucrose nonfermenting-like 4, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI2, transcription activator BRG1 | |
| A synthetic peptide corresponding to a sequence within amino acids 30-130 of human Brg1 (NP_003063.2). PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title