missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BSND Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 267.00 - € 565.00
Specifications
| Antigen | BSND |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18630256
|
Novus Biologicals
NBP2-49101-25ul |
25 μL |
€ 267.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693256
|
Novus Biologicals
NBP2-49101 |
0.1 mL |
€ 565.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BSND Polyclonal antibody specifically detects BSND in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| BSND | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2), 40% Glycerol | |
| 7809 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BARTMGC119284, Bartter syndrome, infantile, with sensorineural deafness (Barttin), barttin, deafness, autosomal recessive 73, DFNB73, MGC119283, MGC119285 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title