missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BTBD1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 198.00 - € 462.00
Specifications
| Antigen | BTBD1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
BTBD1 Polyclonal antibody specifically detects BTBD1 in Mouse samples. It is validated for Western BlotSpecifications
| BTBD1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cell Cycle and Replication | |
| PBS with 50% glycerol, pH7.3. | |
| 53339 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| BTB (POZ) domain containing 1, BTB domain containing 1, BTB/POZ domain-containing protein 1, C15orf1, HCV NS5A-transactivated protein 8, Hepatitis C virus NS5A-transactivated protein 8, NS5ATP8 | |
| A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human BTBD1 (NP_079514.1). CDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title