missing translation for 'onlineSavingsMsg'
Learn More
Learn More
c-Abl Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90289-25ul
This item is not returnable.
View return policy
Description
c-Abl Polyclonal antibody specifically detects c-Abl in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| c-Abl | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Abelson murine leukemia viral oncogene homolog 1, ABL, c-ABL, c-abl oncogene 1, non-receptor tyrosine kinase, c-abl oncogene 1, receptor tyrosine kinase, EC 2.7.10, EC 2.7.10.2, JTK7bcr/abl, p150bcr/c-abl oncogene protein, Proto-oncogene c-Abl, proto-oncogene tyrosine-protein kinase ABL1, tyrosine-protein kinase ABL1, v-abl, v-abl Abelson murine leukemia viral oncogene homolog 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT | |
| 25 μL | |
| Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, DNA Repair, Signal Transduction, Tumor Suppressors | |
| 25 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction