missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C15orf39 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00
Specifications
| Antigen | C15orf39 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C15orf39 Polyclonal specifically detects C15orf39 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| C15orf39 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 56905 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TPRCPLDFAPQTLSFPYARDDLSLYGASPGLGGTPPSQNNVRAVPQPGAFQRACQPLPASQPCSEPVRPAQEAEEKTWLPSCRKEKLQPRLSEHSG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| chromosome 15 open reading frame 39, DKFZp434H132, FLJ46337, FP6578, hypothetical protein LOC56905, MGC117209 | |
| C15ORF39 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title