missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C1QB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | C1QB |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18684815
|
Novus Biologicals
NBP2-49033-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18659405
|
Novus Biologicals
NBP2-49033 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C1QB Polyclonal antibody specifically detects C1QB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| C1QB | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Immunology, Innate Immunity, Neurodegeneration, Neuroscience | |
| PBS (pH 7.2), 40% Glycerol | |
| 713 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| B chain, complement C1q subcomponent subunit B, complement component 1, q subcomponent, B chain, complement subcomponent C1q chain B, q subcomponent, beta polypeptide | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title