missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C21orf59 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 529.00
Specifications
| Antigen | C21orf59 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18474801
|
Novus Biologicals
NBP1-88275 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18425641
|
Novus Biologicals
NBP1-88275-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C21orf59 Polyclonal antibody specifically detects C21orf59 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| C21orf59 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol | |
| 56683 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| C21orf48, chromosome 21 open reading frame 48, chromosome 21 open reading frame 59, FLJ20467, FLJ37137, FLJ40247, hypothetical protein LOC56683, kur, kurly | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title