missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C3orf38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48626-25ul
This item is not returnable.
View return policy
Description
C3orf38 Polyclonal antibody specifically detects C3orf38 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| C3orf38 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| chromosome 3 open reading frame 38, FLJ54270, hypothetical protein LOC285237, MGC26717 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FGLIRCPFVENTWKIKFINLKIMGESSLAPGTLPKPSVKFEQSDLEAFYNVITVCGTNEVRHNVKQASDSGTG | |
| 25 μL | |
| Lipid and Metabolism | |
| 285237 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur