missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C4.4A/LYPD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-32598-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
C4.4A/LYPD3 Polyclonal specifically detects C4.4A/LYPD3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| C4.4A/LYPD3 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C4.4A2310061G07Rik, GPI-anchored metastasis-associated protein C4.4A homolog, GPI-anchored metastasis-associated protein homolog, LY6/PLAUR domain containing 3, ly6/PLAUR domain-containing protein 3, Matrigel-induced gene C4 protein, MIG-C4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 27076 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| LYPD3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGN | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto