missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C4.4A/LYPD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 575.40
Specifications
| Antigen | C4.4A/LYPD3 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18418751
|
Novus Biologicals
NBP2-32605-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18015114
|
Novus Biologicals
NBP2-32605 |
0.1 mL |
€ 609.00 € 575.40 / 0.10mL Save € 33.60 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C4.4A/LYPD3 Polyclonal specifically detects C4.4A/LYPD3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C4.4A/LYPD3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 27076 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C4.4A2310061G07Rik, GPI-anchored metastasis-associated protein C4.4A homolog, GPI-anchored metastasis-associated protein homolog, LY6/PLAUR domain containing 3, ly6/PLAUR domain-containing protein 3, Matrigel-induced gene C4 protein, MIG-C4 | |
| LYPD3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title