missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C4 binding protein A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | C4 binding protein A |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228259
|
Novus Biologicals
NBP3-38450-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231358
|
Novus Biologicals
NBP3-38450-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C4 binding protein A Polyclonal antibody specifically detects C4 binding protein A in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| C4 binding protein A | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Immunology, Innate Immunity | |
| PBS (pH 7.3), 50% glycerol | |
| 722 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| C4b binding protein, alpha chain, C4b-binding protein alpha chain, C4BP, complement component 4 binding protein, alpha, complement component 4 binding protein, alpha chain, complement component 4-binding protein, alpha, Proline-rich protein, PRP | |
| A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4 binding protein A (NP_000706.1).,, Sequence:, QYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title