missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CA125/MUC16 Antibody (CL2782), Novus Biologicals™
Mouse Monoclonal Antibody
€ 369.00 - € 549.00
Specifications
| Antigen | CA125/MUC16 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18287121
|
Novus Biologicals
NBP2-59023 |
100 μL |
€ 549.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646276
|
Novus Biologicals
NBP2-59023-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CA125/MUC16 Monoclonal specifically detects CA125/MUC16 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CA125/MUC16 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| CA-125, CA125 ovarian cancer antigen, CA125MUC-16, FLJ14303, mucin 16, cell surface associated, mucin-16, Ovarian cancer-related tumor marker CA125, Ovarian carcinoma antigen CA125 | |
| MUC16 | |
| IgG1 | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Unconjugated | |
| Mouse | |
| Cellular Markers, Extracellular Matrix, Tumor Biomarkers | |
| Q8WXI7 | |
| 94025 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title