missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CACNA2D2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 292.00 - € 725.00
Specifications
| Antigen | CACNA2D2 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18477940
|
Novus Biologicals
NBP1-81501-25ul |
25ul |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18220616
|
Novus Biologicals
NBP1-81501 |
0.1 mL |
€ 725.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CACNA2D2 Polyclonal specifically detects CACNA2D2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| CACNA2D2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| alpha 2 delta calcium channel subunit, CACNA2D, calcium channel, voltage-dependent, alpha 2/delta subunit 2, gene 26, KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2, LUAC11.1, voltage-dependent calcium channel subunit alpha-2/delta-2 | |
| CACNA2D2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9254 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title