missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | CAD |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18283144
|
Novus Biologicals
NBP2-58494 |
100 μL |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18697356
|
Novus Biologicals
NBP2-58494-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CAD Polyclonal specifically detects CAD in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| CAD | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Lipid and Metabolism | |
| CAD protein, CAD trifunctional protein, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, anddihydroorotase, EC 2.1.3.2, EC 3.5.2.3, EC 6.3.5, EC 6.3.5.5, multifunctional protein CAD | |
| CAD | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 790 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title