missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cadherin-17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 369.00 - € 500.00
Specifications
| Antigen | Cadherin-17 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18435231
|
Novus Biologicals
NBP1-88238-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18706013
|
Novus Biologicals
NBP1-88238 |
€ 500.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
Cadherin-17 Polyclonal specifically detects Cadherin-17 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cadherin-17 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| cadherin, cadherin 17, LI cadherin (liver-intestine), cadherin-16, cadherin-17, CDH16, FLJ26931, HPT1, HPT-1, HPT-1 cadherin, human intestinal peptide-associated transporter HPT-1, human peptide transporter 1, Intestinal peptide-associated transporter HPT-1, LI cadherin, LI-cadherin, Liver-intestine cadherin, MGC138218, MGC142024 | |
| CDH17 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1015 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title