missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calmodulin Rabbit anti-Human, Mouse, Rat, Clone: 10W3Y7, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 219.00 - € 508.00
Specifications
| Antigen | Calmodulin |
|---|---|
| Clone | 10W3Y7 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18009215
|
Novus Biologicals
NBP3-16500-20UL |
20 μg |
€ 219.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18390922
|
Bio-Techne
NBP3-16500-100UL |
100 μg |
€ 508.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Calmodulin Monoclonal antibody specifically detects Calmodulin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, ImmunofluorescenceSpecifications
| Calmodulin | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CALM, CALM2, CALM3, CALML2, calmodulin, calmodulin 1 (phosphorylase kinase, delta), CaM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMI, CAMIII, DD132, PHKDCAM, phosphorylase kinase, delta subunit | |
| A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (P0DP23). LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 10W3Y7 | |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Neuroscience, Neurotransmission, Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 801 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title