missing translation for 'onlineSavingsMsg'
Learn More

CaM Kinase II gamma Antibody, Novus Biologicals™

Product Code. 30230081 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30230081 20 μL 20µL
30227991 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30230081 Supplier Novus Biologicals Supplier No. NBP33796420ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CaM Kinase II gamma Polyclonal antibody specifically detects CaM Kinase II gamma in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CaM Kinase II gamma
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:100
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma, calcium/calmodulin-dependent protein kinase II gamma, calcium/calmodulin-dependent protein kinase type II subunit gamma, CaM kinase II subunit gamma, CAMK, CAMKGFLJ16043, CAMK-II, CaMK-II subunit gamma, EC 2.7.11, EC 2.7.11.17, MGC26678
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CaM Kinase II gamma (NP_751909.1).,, Sequence:, LKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAI
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Kinase, Signal Transduction, Tyrosine Kinases, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 818
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.